PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Achn045931
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; Ericales; Actinidiaceae; Actinidia
Family Nin-like
Protein Properties Length: 263aa    MW: 30271.6 Da    PI: 8.846
Description Nin-like family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Achn045931genomeIKGCView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1RWP-RK83.12.7e-26152201352
      RWP-RK   3 keisledlskyFslpikdAAkeLgvclTvLKriCRqyGIkRWPhRkiksl 52 
                 + + l++++kyF+ pi++AAkeL+v+lTvLK++CR+++I+RWPhRkiksl
  Achn045931 152 AALGLDEIQKYFDVPITKAAKELKVGLTVLKKRCRELNIMRWPHRKIKSL 201
                 67899*******************************************97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5151917.496137221IPR003035RWP-RK domain
PfamPF020424.5E-23154201IPR003035RWP-RK domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0009793Biological Processembryo development ending in seed dormancy
GO:0005634Cellular Componentnucleus
Sequence ? help Back to Top
Protein Sequence    Length: 263 aa     Download sequence    Send to blast
MHIIVSKYIK DFGYDLSKFD RAKNLTLSPI IRIFDQQLSS TDTFDHLINN FLEIDQCKPP  60
YQKNHITHFE FRDFEDINGD ISSWNVNIPA FYEGYTLDPK LLCAVEENSF DQMGSFGSVE  120
SEFPDGIQRN FSSSSGSGEG QIRQSSGRSK SAALGLDEIQ KYFDVPITKA AKELKVGLTV  180
LKKRCRELNI MRWPHRKIKS LKSLIHNVKE LGLTTEIEML EEHRRMLEKL PELELTERTK  240
KLRQACFKAN YKKRRSLAAL TN*
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_007039079.19e-74RWP-RK domain-containing protein, putative
TrEMBLA0A061G1541e-73A0A061G154_THECC; RWP-RK domain-containing protein, putative
STRINGSolyc03g083040.1.14e-59(Solanum lycopersicum)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA121431922
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G53040.11e-44RWP-RK domain-containing protein